Lineage for d1fjma_ (1fjm A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513455Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 513456Superfamily d.159.1: Metallo-dependent phosphatases [56300] (7 families) (S)
  5. 513496Family d.159.1.3: Protein serine/threonine phosphatase [56310] (4 proteins)
  6. 513502Protein Protein phosphatase-1 (PP-1) [56311] (3 species)
  7. 513510Species Rabbit (Oryctolagus cuniculus), alpha isoform [TaxId:9986] [56312] (1 PDB entry)
  8. 513511Domain d1fjma_: 1fjm A: [42082]

Details for d1fjma_

PDB Entry: 1fjm (more details), 2.1 Å

PDB Description: Protein serine/threonine phosphatase-1 (alpha isoform, type 1) complexed with microcystin-LR toxin

SCOP Domain Sequences for d1fjma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjma_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Rabbit (Oryctolagus cuniculus), alpha isoform}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad

SCOP Domain Coordinates for d1fjma_:

Click to download the PDB-style file with coordinates for d1fjma_.
(The format of our PDB-style files is described here.)

Timeline for d1fjma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fjmb_