Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (38 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:1061] [420549] (2 PDB entries) |
Domain d7azre2: 7azr E:92-200 [420806] Other proteins in same PDB: d7azra1, d7azre1 automated match to d4yipa2 complexed with ca, mn |
PDB Entry: 7azr (more details), 2.1 Å
SCOPe Domain Sequences for d7azre2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7azre2 d.44.1.0 (E:92-200) automated matches {Rhodobacter capsulatus [TaxId: 1061]} gedkkmpgalekalvesfgsvakfkedfaaagagqfgsgwawlvkdsdgalkitktengv nplcfgqtallgcdvwehsyyidfrnkrpayltnfldklvnwenvasrm
Timeline for d7azre2: