Lineage for d7azre2 (7azr E:92-200)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 3084232Species Rhodobacter capsulatus [TaxId:1061] [420549] (2 PDB entries)
  8. 3084489Domain d7azre2: 7azr E:92-200 [420806]
    Other proteins in same PDB: d7azra1, d7azre1
    automated match to d4yipa2
    complexed with ca, mn

Details for d7azre2

PDB Entry: 7azr (more details), 2.1 Å

PDB Description: crystal structure of the iron/manganese cambialistic superoxide dismutase from rhodobacter capsulatus complex with mn
PDB Compounds: (E:) superoxide dismutase [fe]

SCOPe Domain Sequences for d7azre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7azre2 d.44.1.0 (E:92-200) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
gedkkmpgalekalvesfgsvakfkedfaaagagqfgsgwawlvkdsdgalkitktengv
nplcfgqtallgcdvwehsyyidfrnkrpayltnfldklvnwenvasrm

SCOPe Domain Coordinates for d7azre2:

Click to download the PDB-style file with coordinates for d7azre2.
(The format of our PDB-style files is described here.)

Timeline for d7azre2:

  • d7azre2 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7azre1