Lineage for d1utea_ (1ute A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679879Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 1679880Protein Mammalian purple acid phosphatase [56304] (2 species)
  7. 1679884Species Pig (Sus scrofa) [TaxId:9823] [56306] (1 PDB entry)
  8. 1679885Domain d1utea_: 1ute A: [42078]
    complexed with feo, ipa, po4

Details for d1utea_

PDB Entry: 1ute (more details), 1.55 Å

PDB Description: pig purple acid phosphatase complexed with phosphate
PDB Compounds: (A:) protein (II purple acid phosphatase)

SCOPe Domain Sequences for d1utea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]}
ptpilrfvavgdwggvpnapfhtaremanakaiattvktlgadfilslgdnfyftgvhda
kdkrfqetfedvfsdpslrnvpwhvlagnhdhlgnvsaqiayskiskrwnfpspyyrlrf
kiprsnvsvaifmldtvtlcgnsddfvsqqperprnlalartqlawikkqlaaakedyvl
vaghypvwsiaehgpthclvkqllplltthkvtaylcghdhnlqylqdenglgfvlsgag
nfmdpskkhlrkvpngylrfhfgaenslggfayveitpkemsvtyieasgkslfktklpr
ra

SCOPe Domain Coordinates for d1utea_:

Click to download the PDB-style file with coordinates for d1utea_.
(The format of our PDB-style files is described here.)

Timeline for d1utea_: