SCOPe 2.03: Domain d1utea_: 1ute A:

Lineage for d1utea_ (1ute A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)

6. Protein Mammalian purple acid phosphatase [56304] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [56306] (1 PDB entry)

8. Domain d1utea_: 1ute A: [42078]
   complexed with feo, ipa, po4

Details for d1utea_

PDB Entry: 1ute, 1.55 Å

PDB Description: pig purple acid phosphatase complexed with phosphate

PDB Compounds: (A:) protein (II purple acid phosphatase)

SCOPe Domain Sequences for d1utea_:

Sequence; same for both SEQRES and ATOM records:

>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]}
ptpilrfvavgdwggvpnapfhtaremanakaiattvktlgadfilslgdnfyftgvhda
kdkrfqetfedvfsdpslrnvpwhvlagnhdhlgnvsaqiayskiskrwnfpspyyrlrf
kiprsnvsvaifmldtvtlcgnsddfvsqqperprnlalartqlawikkqlaaakedyvl
vaghypvwsiaehgpthclvkqllplltthkvtaylcghdhnlqylqdenglgfvlsgag
nfmdpskkhlrkvpngylrfhfgaenslggfayveitpkemsvtyieasgkslfktklpr
ra

Timeline for d1utea_:

• d1utea_ first appeared (with stable ids) in SCOP 1.55
  
• d1utea_ appears in SCOPe 2.02
  
• d1utea_ appears in SCOPe 2.04
  
• d1utea_ appears in the current release, SCOPe 2.08