Lineage for d1utea_ (1ute A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85146Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
  4. 85147Superfamily d.159.1: Metallo-dependent phosphatases [56300] (4 families) (S)
  5. 85148Family d.159.1.1: Purple acid phosphatase [56301] (2 proteins)
  6. 85149Protein Mammalian purple acid phosphatase [56304] (2 species)
  7. 85150Species Pig (Sus scrofa) [TaxId:9823] [56306] (1 PDB entry)
  8. 85151Domain d1utea_: 1ute A: [42078]

Details for d1utea_

PDB Entry: 1ute (more details), 1.55 Å

PDB Description: pig purple acid phosphatase complexed with phosphate

SCOP Domain Sequences for d1utea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa)}
ptpilrfvavgdwggvpnapfhtaremanakaiattvktlgadfilslgdnfyftgvhda
kdkrfqetfedvfsdpslrnvpwhvlagnhdhlgnvsaqiayskiskrwnfpspyyrlrf
kiprsnvsvaifmldtvtlcgnsddfvsqqperprnlalartqlawikkqlaaakedyvl
vaghypvwsiaehgpthclvkqllplltthkvtaylcghdhnlqylqdenglgfvlsgag
nfmdpskkhlrkvpngylrfhfgaenslggfayveitpkemsvtyieasgkslfktklpr
ra

SCOP Domain Coordinates for d1utea_:

Click to download the PDB-style file with coordinates for d1utea_.
(The format of our PDB-style files is described here.)

Timeline for d1utea_: