Lineage for d1qfca_ (1qfc A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679879Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 1679880Protein Mammalian purple acid phosphatase [56304] (2 species)
  7. 1679881Species Norway rat (Rattus norvegicus) [TaxId:10116] [56305] (2 PDB entries)
  8. 1679883Domain d1qfca_: 1qfc A: [42077]
    complexed with fe, nag, po4

Details for d1qfca_

PDB Entry: 1qfc (more details), 2.7 Å

PDB Description: structure of rat purple acid phosphatase
PDB Compounds: (A:) protein (purple acid phosphatase)

SCOPe Domain Sequences for d1qfca_:

Sequence, based on SEQRES records: (download)

>d1qfca_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tapastlrfvavgdwggvpnapfhtaremanakeiartvqimgadfimslgdnfyftgvh
dandkrfqetfedvfsdralrnipwyvlagnhdhlgnvsaqiayskiskrwnfpspyyrl
rfkvprsnitvaifmldtvmlcgnsddfvsqqpemprdlgvartqlswlkkqlaaakedy
vlvaghypiwsiaehgptrclvknlrpllaaygvtaylcghdhnlqylqdengvgyvlsg
agnfmdpsvrhqrkvpngylrfhygsedslggftyveigskemsityveasgkslfktsl
pr

Sequence, based on observed residues (ATOM records): (download)

>d1qfca_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tapastlrfvavgdwggvpnapfhtaremanakeiartvqimgadfimslgdnfyftgvh
dandkrfqetfedvfsdralrnipwyvlagnhdhlgnvsaqiayskiskrwnfpspyyrl
rfkvprsnitvaifmldtvmlcgnsvartqlswlkkqlaaakedyvlvaghypiwsiaeh
gptrclvknlrpllaaygvtaylcghdhnlqylqdengvgyvlsgagnfmdpsvrhqrkv
pngylrfhygsedslggftyveigskemsityveasgkslfktslpr

SCOPe Domain Coordinates for d1qfca_:

Click to download the PDB-style file with coordinates for d1qfca_.
(The format of our PDB-style files is described here.)

Timeline for d1qfca_: