Lineage for d1qhwa_ (1qhw A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938246Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1938247Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1938248Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 1938249Protein Mammalian purple acid phosphatase [56304] (2 species)
  7. 1938250Species Norway rat (Rattus norvegicus) [TaxId:10116] [56305] (2 PDB entries)
  8. 1938251Domain d1qhwa_: 1qhw A: [42076]
    complexed with fe, so4, zn

Details for d1qhwa_

PDB Entry: 1qhw (more details), 2.2 Å

PDB Description: purple acid phosphatase from rat bone
PDB Compounds: (A:) protein (purple acid phosphatase)

SCOPe Domain Sequences for d1qhwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhwa_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
stlrfvavgdwggvpnapfhtaremanakeiartvqimgadfimslgdnfyftgvhdand
krfqetfedvfsdralrnipwyvlagnhdhlgnvsaqiayskiskrwnfpspyyrlrfkv
prsnitvaifmldtvmlcgnsddfvsqqpemprdlgvartqlswlkkqlaaakedyvlva
ghypiwsiaehgptrclvknlrpllaaygvtaylcghdhnlqylqdengvgyvlsgagnf
mdpsvrhqrkvpngylrfhygsedslggftyveigskemsityveasgkslfktslprrp

SCOPe Domain Coordinates for d1qhwa_:

Click to download the PDB-style file with coordinates for d1qhwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qhwa_: