Lineage for d1qhwa_ (1qhw A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138907Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
  4. 138908Superfamily d.159.1: Metallo-dependent phosphatases [56300] (4 families) (S)
  5. 138909Family d.159.1.1: Purple acid phosphatase [56301] (2 proteins)
  6. 138910Protein Mammalian purple acid phosphatase [56304] (2 species)
  7. 138913Species Rat (Rattus norvegicus) [TaxId:10116] [56305] (2 PDB entries)
  8. 138914Domain d1qhwa_: 1qhw A: [42076]

Details for d1qhwa_

PDB Entry: 1qhw (more details), 2.2 Å

PDB Description: purple acid phosphatase from rat bone

SCOP Domain Sequences for d1qhwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhwa_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Rat (Rattus norvegicus)}
stlrfvavgdwggvpnapfhtaremanakeiartvqimgadfimslgdnfyftgvhdand
krfqetfedvfsdralrnipwyvlagnhdhlgnvsaqiayskiskrwnfpspyyrlrfkv
prsnitvaifmldtvmlcgnsddfvsqqpemprdlgvartqlswlkkqlaaakedyvlva
ghypiwsiaehgptrclvknlrpllaaygvtaylcghdhnlqylqdengvgyvlsgagnf
mdpsvrhqrkvpngylrfhygsedslggftyveigskemsityveasgkslfktslprrp

SCOP Domain Coordinates for d1qhwa_:

Click to download the PDB-style file with coordinates for d1qhwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qhwa_: