Lineage for d3kbpc2 (3kbp C:121-432)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) Superfamily d.159.1: Metallo-dependent phosphatases [56300] (4 families) 
Family d.159.1.1: Purple acid phosphatase [56301] (2 proteins) 
Protein Plant purple acid phosphatase, catalytic domain [56302] (1 species) Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [56303] (3 PDB entries) 
Domain d3kbpc2: 3kbp C:121-432 [42074]
Other proteins in same PDB: d3kbpa1, d3kbpb1, d3kbpc1, d3kbpd1
Details for d3kbpc2
PDB Entry: 3kbp (more details), 3 Å
PDB Description: kidney bean purple acid phosphatase
SCOP Domain Sequences for d3kbpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kbpc2 d.159.1.1 (C:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris)}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst
SCOP Domain Coordinates for d3kbpc2:
Click to download the PDB-style file with coordinates for d3kbpc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3kbpc2:
View in 3D
