Lineage for d1kbpd2 (1kbp D:121-432)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938246Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1938247Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1938248Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 1938255Protein Plant purple acid phosphatase, catalytic domain [56302] (2 species)
    also contain an Ig-like domain
  7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [56303] (3 PDB entries)
  8. 1938260Domain d1kbpd2: 1kbp D:121-432 [42071]
    Other proteins in same PDB: d1kbpa1, d1kbpb1, d1kbpc1, d1kbpd1
    complexed with fe, nag, zn

Details for d1kbpd2

PDB Entry: 1kbp (more details), 2.65 Å

PDB Description: kidney bean purple acid phosphatase
PDB Compounds: (D:) purple acid phosphatase

SCOPe Domain Sequences for d1kbpd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbpd2 d.159.1.1 (D:121-432) Plant purple acid phosphatase, catalytic domain {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst

SCOPe Domain Coordinates for d1kbpd2:

Click to download the PDB-style file with coordinates for d1kbpd2.
(The format of our PDB-style files is described here.)

Timeline for d1kbpd2: