| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
| Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
| Protein Plant purple acid phosphatase, catalytic domain [56302] (2 species) also contain an Ig-like domain |
| Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [56303] (5 PDB entries) |
| Domain d1kbpa2: 1kbp A:121-432 [42068] Other proteins in same PDB: d1kbpa1, d1kbpb1, d1kbpc1, d1kbpd1 complexed with fe, nag, zn |
PDB Entry: 1kbp (more details), 2.65 Å
SCOPe Domain Sequences for d1kbpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbpa2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst
Timeline for d1kbpa2: