SCOPe 2.08: Domain d7b4jb1: 7b4j B:7-455

Lineage for d7b4jb1 (7b4j B:7-455)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:306] [315480] (8 PDB entries)

8. Domain d7b4jb1: 7b4j B:7-455 [420676]
   Other proteins in same PDB: d7b4jb2
   automated match to d6s4gd_
   complexed with pmp, sin

Details for d7b4jb1

PDB Entry: 7b4j, 1.9 Å

PDB Description: thermostable omega transaminase pjta-r6 variant w58m/f86l/r417l engineered for asymmetric synthesis of enantiopure bulky amines

PDB Compounds: (B:) Aspartate aminotransferase family protein

SCOPe Domain Sequences for d7b4jb1:

Sequence; same for both SEQRES and ATOM records:

>d7b4jb1 c.67.1.0 (B:7-455) automated matches {Pseudomonas sp. [TaxId: 306]}
slaekdiqyqlhpytnarlhqelgpliiergqgiyvyddqgkgyieamaglmsvalgfsn
qrlikaaeqqfntlpfyhllnhkshrpsielaekliemapvpmskvfftnsgseandtvv
kfvwylnnalgkpakkkfisrvngyhgvtvasasltglpgnqrgfdlplpgflhvgcphh
yrfalageseehfadrlaveleqkilaegpetiaafigeplmgaggvivpprtywekiqk
vcrkydilviadevicgfgrtgqmfgsqtfgiqpdimvlskqlsssyqpiaailinapvf
egiadqsqalgalghgftgsghpvatavalenlkiieeeslvehaaqmgqllrsglqhfi
dhplvgeirgcgliaavelvgdrvskapyqalgtlgrymagraqehgmitlamgdavafc
pplivneqevgmiverfaralddttqwvg

Timeline for d7b4jb1:

• d7b4jb1 is new in SCOPe 2.08-stable