![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
![]() | Protein Plant purple acid phosphatase, catalytic domain [56302] (2 species) also contain an Ig-like domain |
![]() | Domain d4kbpc2: 4kbp C:121-432 [42066] Other proteins in same PDB: d4kbpa1, d4kbpb1, d4kbpc1, d4kbpd1 complexed with fe, nag, po4, zn |
PDB Entry: 4kbp (more details), 2.7 Å
SCOPe Domain Sequences for d4kbpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kbpc2 d.159.1.1 (C:121-432) Plant purple acid phosphatase, catalytic domain {French bean (Phaseolus vulgaris) [TaxId: 3885]} qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf fnrhwypvddst
Timeline for d4kbpc2: