Lineage for d4kbpc2 (4kbp C:121-432)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1046630Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1046631Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1046632Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 1046639Protein Plant purple acid phosphatase, catalytic domain [56302] (2 species)
    also contain an Ig-like domain
  7. 1046640Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [56303] (5 PDB entries)
  8. 1046653Domain d4kbpc2: 4kbp C:121-432 [42066]
    Other proteins in same PDB: d4kbpa1, d4kbpb1, d4kbpc1, d4kbpd1
    complexed with fe, nag, po4, zn

Details for d4kbpc2

PDB Entry: 4kbp (more details), 2.7 Å

PDB Description: kidney bean purple acid phosphatase
PDB Compounds: (C:) purple acid phosphatase

SCOPe Domain Sequences for d4kbpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kbpc2 d.159.1.1 (C:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst

SCOPe Domain Coordinates for d4kbpc2:

Click to download the PDB-style file with coordinates for d4kbpc2.
(The format of our PDB-style files is described here.)

Timeline for d4kbpc2: