Lineage for d4kbpc2 (4kbp C:121-432)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85146Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
  4. 85147Superfamily d.159.1: Metallo-dependent phosphatases [56300] (4 families) (S)
  5. 85148Family d.159.1.1: Purple acid phosphatase [56301] (2 proteins)
  6. 85155Protein Plant purple acid phosphatase, catalytic domain [56302] (1 species)
  7. 85156Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [56303] (3 PDB entries)
  8. 85159Domain d4kbpc2: 4kbp C:121-432 [42066]
    Other proteins in same PDB: d4kbpa1, d4kbpb1, d4kbpc1, d4kbpd1

Details for d4kbpc2

PDB Entry: 4kbp (more details), 2.7 Å

PDB Description: kidney bean purple acid phosphatase

SCOP Domain Sequences for d4kbpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kbpc2 d.159.1.1 (C:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris)}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst

SCOP Domain Coordinates for d4kbpc2:

Click to download the PDB-style file with coordinates for d4kbpc2.
(The format of our PDB-style files is described here.)

Timeline for d4kbpc2: