SCOPe 2.08: Domain d7azta2: 7azt A:216-503

Lineage for d7azta2 (7azt A:216-503)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
   multihelical; consists of two all-alpha subdomains

4. Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families)
   automatically mapped to Pfam PF03441

5. Family a.99.1.0: automated matches [231382] (1 protein)
   not a true family

6. Protein automated matches [231383] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231384] (8 PDB entries)

8. Domain d7azta2: 7azt A:216-503 [420646]
   Other proteins in same PDB: d7azta1
   automated match to d2wq7a2
   complexed with fad

Details for d7azta2

PDB Entry: 7azt, 2.27 Å

PDB Description: x-ray crystallographic structure of (6-4)photolyase from drosophila melanogaster at room temperature

PDB Compounds: (A:) RE11660p

SCOPe Domain Sequences for d7azta2:

Sequence; same for both SEQRES and ATOM records:

>d7azta2 a.99.1.0 (A:216-503) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gpnkfpggetealrrmeeslkdeiwvarfekpntapnslepsttvlspylkfgclsarlf
nqklkeiikrqpkhsqppvsligqlmwrefyytvaaaepnfdrmlgnvycmqipwqehpd
hleawthgrtgypfidaimrqlrqegwihhlarhavacfltrgdlwisweegqrvfeqll
ldqdwalnagnwmwlsasaffhqyfrvyspvafgkktdpqghyirkyvpelskypagciy
epwkaslvdqraygcvlgtdyphrivkhevvhkenikrmgaaykvnre

Timeline for d7azta2:

• d7azta2 is new in SCOPe 2.08-stable