Lineage for d4kbpa2 (4kbp A:121-432)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36927Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
  4. 36928Superfamily d.159.1: Metallo-dependent phosphatases [56300] (3 families) (S)
  5. 36929Family d.159.1.1: Purple acid phosphatase [56301] (2 proteins)
  6. 36936Protein Plant purple acid phosphatase, catalytic domain [56302] (1 species)
  7. 36937Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [56303] (3 PDB entries)
  8. 36938Domain d4kbpa2: 4kbp A:121-432 [42064]
    Other proteins in same PDB: d4kbpa1, d4kbpb1, d4kbpc1, d4kbpd1

Details for d4kbpa2

PDB Entry: 4kbp (more details), 2.7 Å

PDB Description: kidney bean purple acid phosphatase

SCOP Domain Sequences for d4kbpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kbpa2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris)}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst

SCOP Domain Coordinates for d4kbpa2:

Click to download the PDB-style file with coordinates for d4kbpa2.
(The format of our PDB-style files is described here.)

Timeline for d4kbpa2: