Lineage for d1e5db2 (1e5d B:2-250)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876590Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 876591Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) (S)
  5. 876696Family d.157.1.3: ROO N-terminal domain-like [56291] (3 proteins)
  6. 876715Protein Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain [56292] (1 species)
  7. 876716Species Desulfovibrio gigas [TaxId:879] [56293] (1 PDB entry)
  8. 876718Domain d1e5db2: 1e5d B:2-250 [42062]
    Other proteins in same PDB: d1e5da1, d1e5db1
    complexed with feo, fmn, oxy

Details for d1e5db2

PDB Entry: 1e5d (more details), 2.5 Å

PDB Description: rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas
PDB Compounds: (B:) rubredoxin:oxygen oxidoreductase

SCOP Domain Sequences for d1e5db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5db2 d.157.1.3 (B:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]}
qatkiidgfhlvgaidwnsrdfhgytlspmgttynaylvedekttlfdtvkaeykgellc
giasvidpkkidylviqhleldhagalpalieacqpekiftsslgqkameshfhykdwpv
qvvkhgetlslgkrtvtfyetrmlhwpdsmvswfadekvlisndifgqniaaserfsdqi
pvhtleramreyyanivnpyapqtlkaietlvgagvapeficpdhgvifrgadqctfavq
kyveyaeqk

SCOP Domain Coordinates for d1e5db2:

Click to download the PDB-style file with coordinates for d1e5db2.
(The format of our PDB-style files is described here.)

Timeline for d1e5db2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e5db1