SCOP 1.69: Domain d1e5db2: 1e5d B:2-250

Lineage for d1e5db2 (1e5d B:2-250)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (5 families)

5. Family d.157.1.3: ROO N-terminal domain-like [56291] (2 proteins)

6. Protein Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain [56292] (1 species)

7. Species Desulfovibrio gigas [TaxId:879] [56293] (1 PDB entry)

8. Domain d1e5db2: 1e5d B:2-250 [42062]
   Other proteins in same PDB: d1e5da1, d1e5db1

Details for d1e5db2

PDB Entry: 1e5d, 2.5 Å

PDB Description: rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas

SCOP Domain Sequences for d1e5db2:

Sequence; same for both SEQRES and ATOM records:

>d1e5db2 d.157.1.3 (B:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas}
qatkiidgfhlvgaidwnsrdfhgytlspmgttynaylvedekttlfdtvkaeykgellc
giasvidpkkidylviqhleldhagalpalieacqpekiftsslgqkameshfhykdwpv
qvvkhgetlslgkrtvtfyetrmlhwpdsmvswfadekvlisndifgqniaaserfsdqi
pvhtleramreyyanivnpyapqtlkaietlvgagvapeficpdhgvifrgadqctfavq
kyveyaeqk

Timeline for d1e5db2:

• d1e5db2 first appeared (with stable ids) in SCOP 1.55
  
• d1e5db2 appears in SCOP 1.67
  
• d1e5db2 appears in SCOP 1.71
  
• d1e5db2 appears in the current release, SCOPe 2.08