Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (5 families) |
Family d.157.1.3: ROO N-terminal domain-like [56291] (2 proteins) |
Protein Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain [56292] (1 species) |
Species Desulfovibrio gigas [TaxId:879] [56293] (1 PDB entry) |
Domain d1e5db2: 1e5d B:2-250 [42062] Other proteins in same PDB: d1e5da1, d1e5db1 |
PDB Entry: 1e5d (more details), 2.5 Å
SCOP Domain Sequences for d1e5db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5db2 d.157.1.3 (B:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas} qatkiidgfhlvgaidwnsrdfhgytlspmgttynaylvedekttlfdtvkaeykgellc giasvidpkkidylviqhleldhagalpalieacqpekiftsslgqkameshfhykdwpv qvvkhgetlslgkrtvtfyetrmlhwpdsmvswfadekvlisndifgqniaaserfsdqi pvhtleramreyyanivnpyapqtlkaietlvgagvapeficpdhgvifrgadqctfavq kyveyaeqk
Timeline for d1e5db2: