Lineage for d1e5db2 (1e5d B:2-250)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36875Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
  4. 36876Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (3 families) (S)
  5. 36916Family d.157.1.3: Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain [56291] (1 protein)
  6. 36917Protein Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain [56292] (1 species)
  7. 36918Species Desulfovibrio gigas [TaxId:879] [56293] (1 PDB entry)
  8. 36920Domain d1e5db2: 1e5d B:2-250 [42062]
    Other proteins in same PDB: d1e5da1, d1e5db1

Details for d1e5db2

PDB Entry: 1e5d (more details), 2.5 Å

PDB Description: rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas

SCOP Domain Sequences for d1e5db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5db2 d.157.1.3 (B:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas}
qatkiidgfhlvgaidwnsrdfhgytlspmgttynaylvedekttlfdtvkaeykgellc
giasvidpkkidylviqhleldhagalpalieacqpekiftsslgqkameshfhykdwpv
qvvkhgetlslgkrtvtfyetrmlhwpdsmvswfadekvlisndifgqniaaserfsdqi
pvhtleramreyyanivnpyapqtlkaietlvgagvapeficpdhgvifrgadqctfavq
kyveyaeqk

SCOP Domain Coordinates for d1e5db2:

Click to download the PDB-style file with coordinates for d1e5db2.
(The format of our PDB-style files is described here.)

Timeline for d1e5db2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e5db1