Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.3: ROO N-terminal domain-like [56291] (3 proteins) |
Protein Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain [56292] (1 species) |
Species Desulfovibrio gigas [TaxId:879] [56293] (1 PDB entry) |
Domain d1e5da2: 1e5d A:2-250 [42061] Other proteins in same PDB: d1e5da1, d1e5db1 complexed with feo, fmn, oxy |
PDB Entry: 1e5d (more details), 2.5 Å
SCOPe Domain Sequences for d1e5da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} qatkiidgfhlvgaidwnsrdfhgytlspmgttynaylvedekttlfdtvkaeykgellc giasvidpkkidylviqhleldhagalpalieacqpekiftsslgqkameshfhykdwpv qvvkhgetlslgkrtvtfyetrmlhwpdsmvswfadekvlisndifgqniaaserfsdqi pvhtleramreyyanivnpyapqtlkaietlvgagvapeficpdhgvifrgadqctfavq kyveyaeqk
Timeline for d1e5da2: