Lineage for d1e5da2 (1e5d A:2-250)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198117Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
  4. 198118Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (3 families) (S)
  5. 198164Family d.157.1.3: Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain [56291] (1 protein)
  6. 198165Protein Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain [56292] (1 species)
  7. 198166Species Desulfovibrio gigas [TaxId:879] [56293] (1 PDB entry)
  8. 198167Domain d1e5da2: 1e5d A:2-250 [42061]
    Other proteins in same PDB: d1e5da1, d1e5db1

Details for d1e5da2

PDB Entry: 1e5d (more details), 2.5 Å

PDB Description: rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas

SCOP Domain Sequences for d1e5da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas}
qatkiidgfhlvgaidwnsrdfhgytlspmgttynaylvedekttlfdtvkaeykgellc
giasvidpkkidylviqhleldhagalpalieacqpekiftsslgqkameshfhykdwpv
qvvkhgetlslgkrtvtfyetrmlhwpdsmvswfadekvlisndifgqniaaserfsdqi
pvhtleramreyyanivnpyapqtlkaietlvgagvapeficpdhgvifrgadqctfavq
kyveyaeqk

SCOP Domain Coordinates for d1e5da2:

Click to download the PDB-style file with coordinates for d1e5da2.
(The format of our PDB-style files is described here.)

Timeline for d1e5da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e5da1