SCOPe 2.08: Domain d7b0wc2: 7b0w C:122-205

Lineage for d7b0wc2 (7b0w C:122-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein FimC [49588] (1 species)

7. Species Escherichia coli [TaxId:562] [49589] (11 PDB entries)

8. Domain d7b0wc2: 7b0w C:122-205 [420560]
   Other proteins in same PDB: d7b0wc1, d7b0wc3, d7b0wi_
   automated match to d1ze3c2
   complexed with edo, fmt

Details for d7b0wc2

PDB Entry: 7b0w, 1.75 Å

PDB Description: crystal structure of the e. coli type 1 pilus assembly inhibitor fimi bound to fimc

PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d7b0wc2:

Sequence; same for both SEQRES and ATOM records:

>d7b0wc2 b.7.2.1 (C:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

Timeline for d7b0wc2:

• d7b0wc2 is new in SCOPe 2.08-stable