Lineage for d1ddka_ (1ddk A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1937673Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1937674Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 1937758Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (7 PDB entries)
  8. 1937769Domain d1ddka_: 1ddk A: [42056]
    complexed with acy, zn

Details for d1ddka_

PDB Entry: 1ddk (more details), 3.1 Å

PDB Description: crystal structure of imp-1 metallo beta-lactamase from pseudomonas aeruginosa
PDB Compounds: (A:) imp-1 metallo beta-lactamase

SCOPe Domain Sequences for d1ddka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddka_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
eslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvt
wfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgv
nywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksak
llkskygkaklvvpshsevgdasllkltleqavkglnesk

SCOPe Domain Coordinates for d1ddka_:

Click to download the PDB-style file with coordinates for d1ddka_.
(The format of our PDB-style files is described here.)

Timeline for d1ddka_: