| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
| Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
| Protein Periplasmic chaperone FimC [49358] (1 species) |
| Species Escherichia coli [TaxId:562] [49359] (11 PDB entries) |
| Domain d7b0wc1: 7b0w C:1-121 [420559] Other proteins in same PDB: d7b0wc2, d7b0wc3, d7b0wi_ automated match to d1ze3c1 complexed with edo, fmt |
PDB Entry: 7b0w (more details), 1.75 Å
SCOPe Domain Sequences for d7b0wc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7b0wc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a
Timeline for d7b0wc1: