SCOPe 2.08: Domain d7b0wc1: 7b0w C:1-121

Lineage for d7b0wc1 (7b0w C:1-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Periplasmic chaperone FimC [49358] (1 species)

7. Species Escherichia coli [TaxId:562] [49359] (11 PDB entries)

8. Domain d7b0wc1: 7b0w C:1-121 [420559]
   Other proteins in same PDB: d7b0wc2, d7b0wc3, d7b0wi_
   automated match to d1ze3c1
   complexed with edo, fmt

Details for d7b0wc1

PDB Entry: 7b0w, 1.75 Å

PDB Description: crystal structure of the e. coli type 1 pilus assembly inhibitor fimi bound to fimc

PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d7b0wc1:

Sequence; same for both SEQRES and ATOM records:

>d7b0wc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Timeline for d7b0wc1:

• d7b0wc1 is new in SCOPe 2.08-stable