SCOPe 2.07: Domain d1dd6b_: 1dd6 B:

Lineage for d1dd6b_ (1dd6 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (12 species)

7. Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (7 PDB entries)

8. Domain d1dd6b_: 1dd6 B: [42055]
   complexed with mci, so4, zn

Details for d1dd6b_

PDB Entry: 1dd6, 2 Å

PDB Description: imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a mercaptocarboxylate inhibitor

PDB Compounds: (B:) imp-1 metallo beta-lactamase

SCOPe Domain Sequences for d1dd6b_:

Sequence; same for both SEQRES and ATOM records:

>d1dd6b_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglnes

Timeline for d1dd6b_:

• d1dd6b_ first appeared (with stable ids) in SCOP 1.55
  
• d1dd6b_ appears in SCOPe 2.06
  
• d1dd6b_ appears in the current release, SCOPe 2.08