Lineage for d1dd6b_ (1dd6 B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36875Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
  4. 36876Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (3 families) (S)
  5. 36877Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 36878Protein Zn metallo-beta-lactamase [56283] (4 species)
  7. 36903Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (2 PDB entries)
  8. 36905Domain d1dd6b_: 1dd6 B: [42055]

Details for d1dd6b_

PDB Entry: 1dd6 (more details), 2 Å

PDB Description: imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a mercaptocarboxylate inhibitor

SCOP Domain Sequences for d1dd6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd6b_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglnes

SCOP Domain Coordinates for d1dd6b_:

Click to download the PDB-style file with coordinates for d1dd6b_.
(The format of our PDB-style files is described here.)

Timeline for d1dd6b_: