Lineage for d1dd6b_ (1dd6 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. Protein Zn metallo-beta-lactamase [56283] (13 species)
  7. Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (7 PDB entries)
  8. Domain d1dd6b_: 1dd6 B: [42055]
    complexed with mci, so4, zn

Details for d1dd6b_

PDB Entry: 1dd6 (more details), 2 Å

PDB Description: imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a mercaptocarboxylate inhibitor
PDB Compounds: (B:) imp-1 metallo beta-lactamase

SCOPe Domain Sequences for d1dd6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd6b_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglnes

SCOPe Domain Coordinates for d1dd6b_ are not available.

Timeline for d1dd6b_:

Domains from other chains:
(mouse over for more information)
d1dd6a_