Lineage for d1a8tb_ (1a8t B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (3 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein) Protein Zn metallo-beta-lactamase [56283] (4 species) 
Species Bacteroides fragilis [56285] (7 PDB entries) 
Domain d1a8tb_: 1a8t B: [42052]
Details for d1a8tb_
PDB Entry: 1a8t (more details), 2.55 Å
PDB Description: metallo-beta-lactamase in complex with l-159,061
SCOP Domain Sequences for d1a8tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8tb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Bacteroides fragilis}
ksvkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqtem
lvnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehg
ftdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqttsignisdadv
tawpktldkvkakfpsaryvvpghgnyggteliehtkqivnqyiests
SCOP Domain Coordinates for d1a8tb_:
Click to download the PDB-style file with coordinates for d1a8tb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a8tb_:
- d1a8tb_ appears in SCOP 1.57
- d1a8tb_ appears in the current release, SCOPe 2.08
View in 3D
