Lineage for d1a8ta_ (1a8t A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1937673Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1937674Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 1937721Species Bacteroides fragilis [TaxId:817] [56285] (9 PDB entries)
  8. 1937738Domain d1a8ta_: 1a8t A: [42051]
    complexed with 061, zn

Details for d1a8ta_

PDB Entry: 1a8t (more details), 2.55 Å

PDB Description: metallo-beta-lactamase in complex with l-159,061
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d1a8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8ta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]}
aqksvkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqt
emlvnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpe
hgftdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqttsignisda
dvtawpktldkvkakfpsaryvvpghgnyggteliehtkqivnqyiests

SCOPe Domain Coordinates for d1a8ta_:

Click to download the PDB-style file with coordinates for d1a8ta_.
(The format of our PDB-style files is described here.)

Timeline for d1a8ta_: