Lineage for d7apza2 (7apz A:86-185)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 3084153Domain d7apza2: 7apz A:86-185 [420470]
    Other proteins in same PDB: d7apza1, d7apza3
    automated match to d6t3ya2
    complexed with ace, imd, nag, ni, peg, zn

Details for d7apza2

PDB Entry: 7apz (more details), 1.97 Å

PDB Description: clip peptide bound to chicken mhc class ii molecule (bl-2) from b2 haplotype with a decamer mode of binding
PDB Compounds: (A:) MHC class II alpha chain

SCOPe Domain Sequences for d7apza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7apza2 b.1.1.0 (A:86-185) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qdfvtpelalfpaeavsleepnvlicyadkfwppvatmewrrngavvsegvydsvyygrp
dllfrkfsylpfvpqrgdvyscavrhwgaegpvqrmwepe

SCOPe Domain Coordinates for d7apza2:

Click to download the PDB-style file with coordinates for d7apza2.
(The format of our PDB-style files is described here.)

Timeline for d7apza2:

  • d7apza2 is new in SCOPe 2.08-stable