![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (5 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries) |
![]() | Domain d7apza1: 7apz A:5-85 [420469] Other proteins in same PDB: d7apza2, d7apza3 automated match to d6kvma1 complexed with ace, imd, nag, ni, peg, zn |
PDB Entry: 7apz (more details), 1.97 Å
SCOPe Domain Sequences for d7apza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7apza1 d.19.1.0 (A:5-85) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} hvllqaefyqrsegpdkawaqfgfhfdadelfhveldaaqtvwrlpefgrfasfeaqgal qnmavgkqnlevmisnsnrsq
Timeline for d7apza1: