Lineage for d7apza1 (7apz A:5-85)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938653Species Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries)
  8. 3084152Domain d7apza1: 7apz A:5-85 [420469]
    Other proteins in same PDB: d7apza2, d7apza3
    automated match to d6kvma1
    complexed with ace, imd, nag, ni, peg, zn

Details for d7apza1

PDB Entry: 7apz (more details), 1.97 Å

PDB Description: clip peptide bound to chicken mhc class ii molecule (bl-2) from b2 haplotype with a decamer mode of binding
PDB Compounds: (A:) MHC class II alpha chain

SCOPe Domain Sequences for d7apza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7apza1 d.19.1.0 (A:5-85) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
hvllqaefyqrsegpdkawaqfgfhfdadelfhveldaaqtvwrlpefgrfasfeaqgal
qnmavgkqnlevmisnsnrsq

SCOPe Domain Coordinates for d7apza1:

Click to download the PDB-style file with coordinates for d7apza1.
(The format of our PDB-style files is described here.)

Timeline for d7apza1:

  • d7apza1 is new in SCOPe 2.08-stable