Lineage for d2bmib_ (2bmi B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224490Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1224491Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1224492Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1224493Protein Zn metallo-beta-lactamase [56283] (11 species)
  7. 1224530Species Bacteroides fragilis [TaxId:817] [56285] (9 PDB entries)
  8. 1224536Domain d2bmib_: 2bmi B: [42044]
    complexed with na, zn

Details for d2bmib_

PDB Entry: 2bmi (more details), 2 Å

PDB Description: metallo-beta-lactamase
PDB Compounds: (B:) protein (class b beta-lactamase)

SCOPe Domain Sequences for d2bmib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmib_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]}
ksvkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqtem
lvnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehg
ftdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisdadv
tawpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiestskp

SCOPe Domain Coordinates for d2bmib_:

Click to download the PDB-style file with coordinates for d2bmib_.
(The format of our PDB-style files is described here.)

Timeline for d2bmib_: