SCOP 1.73: Domain d2bmib_: 2bmi B:

Lineage for d2bmib_ (2bmi B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)

6. Protein Zn metallo-beta-lactamase [56283] (8 species)

7. Species Bacteroides fragilis [TaxId:817] [56285] (9 PDB entries)

8. Domain d2bmib_: 2bmi B: [42044]
   complexed with na, zn

Details for d2bmib_

PDB Entry: 2bmi, 2 Å

PDB Description: metallo-beta-lactamase

PDB Compounds: (B:) protein (class b beta-lactamase)

SCOP Domain Sequences for d2bmib_:

Sequence; same for both SEQRES and ATOM records:

>d2bmib_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]}
ksvkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqtem
lvnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehg
ftdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisdadv
tawpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiestskp

Timeline for d2bmib_:

• d2bmib_ first appeared (with stable ids) in SCOP 1.55
  
• d2bmib_ appears in SCOP 1.71
  
• d2bmib_ appears in SCOP 1.75
  
• d2bmib_ appears in the current release, SCOPe 2.08