Lineage for d2bmib_ (2bmi B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36875Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
  4. 36876Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (3 families) (S)
  5. 36877Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 36878Protein Zn metallo-beta-lactamase [56283] (4 species)
  7. 36888Species Bacteroides fragilis [56285] (7 PDB entries)
  8. 36894Domain d2bmib_: 2bmi B: [42044]

Details for d2bmib_

PDB Entry: 2bmi (more details), 2 Å

PDB Description: metallo-beta-lactamase

SCOP Domain Sequences for d2bmib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmib_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Bacteroides fragilis}
ksvkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqtem
lvnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehg
ftdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisdadv
tawpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiestskp

SCOP Domain Coordinates for d2bmib_:

Click to download the PDB-style file with coordinates for d2bmib_.
(The format of our PDB-style files is described here.)

Timeline for d2bmib_: