Lineage for d7alja1 (7alj A:450-488)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031827Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 3031828Protein automated matches [226968] (5 species)
    not a true protein
  7. 3084118Species Drosophila melanogaster [TaxId:7227] [420435] (1 PDB entry)
  8. 3084119Domain d7alja1: 7alj A:450-488 [420436]
    automated match to d5mwba1
    complexed with bgc, ca, fuc, nag

Details for d7alja1

PDB Entry: 7alj (more details), 1.52 Å

PDB Description: structure of drosophila notch egf domains 11-13
PDB Compounds: (A:) Neurogenic locus Notch protein

SCOPe Domain Sequences for d7alja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7alja1 g.3.11.0 (A:450-488) automated matches {Drosophila melanogaster [TaxId: 7227]}
idecdqgspcehngicvntpgsyrcncsqgftgprcetn

SCOPe Domain Coordinates for d7alja1:

Click to download the PDB-style file with coordinates for d7alja1.
(The format of our PDB-style files is described here.)

Timeline for d7alja1:

  • d7alja1 is new in SCOPe 2.08-stable