Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (5 species) not a true protein |
Species Drosophila melanogaster [TaxId:7227] [420435] (1 PDB entry) |
Domain d7alja1: 7alj A:450-488 [420436] automated match to d5mwba1 complexed with bgc, ca, fuc, nag |
PDB Entry: 7alj (more details), 1.52 Å
SCOPe Domain Sequences for d7alja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7alja1 g.3.11.0 (A:450-488) automated matches {Drosophila melanogaster [TaxId: 7227]} idecdqgspcehngicvntpgsyrcncsqgftgprcetn
Timeline for d7alja1: