Lineage for d2bmia_ (2bmi A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876590Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 876591Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) (S)
  5. 876592Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 876593Protein Zn metallo-beta-lactamase [56283] (10 species)
  7. 876610Species Bacteroides fragilis [TaxId:817] [56285] (9 PDB entries)
  8. 876615Domain d2bmia_: 2bmi A: [42043]

Details for d2bmia_

PDB Entry: 2bmi (more details), 2 Å

PDB Description: metallo-beta-lactamase
PDB Compounds: (A:) protein (class b beta-lactamase)

SCOP Domain Sequences for d2bmia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmia_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]}
svkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqteml
vnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehgf
tdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisdadvt
awpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiestsk

SCOP Domain Coordinates for d2bmia_:

Click to download the PDB-style file with coordinates for d2bmia_.
(The format of our PDB-style files is described here.)

Timeline for d2bmia_: