Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein) |
Protein Zn metallo-beta-lactamase [56283] (10 species) |
Species Bacteroides fragilis [TaxId:817] [56285] (9 PDB entries) |
Domain d2bmia_: 2bmi A: [42043] |
PDB Entry: 2bmi (more details), 2 Å
SCOP Domain Sequences for d2bmia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmia_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} svkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqteml vnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehgf tdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisdadvt awpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiestsk
Timeline for d2bmia_: