Lineage for d1bmca_ (1bmc A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. Protein Zn metallo-beta-lactamase [56283] (13 species)
  7. Species Bacillus cereus [TaxId:1396] [56284] (30 PDB entries)
    Uniprot P04190 31-257
  8. Domain d1bmca_: 1bmc A: [42038]
    complexed with zn

Details for d1bmca_

PDB Entry: 1bmc (more details), 2.5 Å

PDB Description: structure of a zinc metallo-beta-lactamase from bacillus cereus
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d1bmca_:

Sequence, based on SEQRES records: (download)

>d1bmca_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
newstsienvlkryrninavvpghgevgdkglllhtldllk

Sequence, based on observed residues (ATOM records): (download)

>d1bmca_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
tviknetgtisisqlnknvwvhtelpsnglvlntskglvlvdsswddkltkeliemvekk
fqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvtnlk
fgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnewstsie
nvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d1bmca_ are not available.

Timeline for d1bmca_: