Lineage for d7a8va_ (7a8v A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 3084042Species Talaromyces verruculosus [TaxId:198730] [420359] (1 PDB entry)
  8. 3084043Domain d7a8va_: 7a8v A: [420360]
    automated match to d3zuda_
    complexed with cu, man, nag, so4

Details for d7a8va_

PDB Entry: 7a8v (more details), 1.95 Å

PDB Description: crystal structure of polysaccharide monooxygenase from p.verruculosum
PDB Compounds: (A:) Lytic polysaccharide monooxygenase

SCOPe Domain Sequences for d7a8va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a8va_ b.1.18.0 (A:) automated matches {Talaromyces verruculosus [TaxId: 198730]}
hgyvqnividgesysgyivtqfpyesnppavigwattatdlgyvdpteytnadiichkna
tpgalsapvaaggtvelqwttwpdshhgpvisylancngncstvdktkldfvkidasgli
ddttvpgtwasdqliaannswtvtipetiapgnyvlrheiialhsaentdgaqnypqcin
leitgsgtasptgtpgeelytptdpgilvniyqslstyvipgptlwsgaa

SCOPe Domain Coordinates for d7a8va_:

Click to download the PDB-style file with coordinates for d7a8va_.
(The format of our PDB-style files is described here.)

Timeline for d7a8va_:

  • d7a8va_ is new in SCOPe 2.08-stable