Lineage for d1dxka_ (1dxk A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876590Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 876591Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) (S)
  5. 876592Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 876593Protein Zn metallo-beta-lactamase [56283] (10 species)
  7. 876600Species Bacillus cereus [TaxId:1396] [56284] (7 PDB entries)
    Uniprot P04190 31-257
  8. 876606Domain d1dxka_: 1dxk A: [42036]
    complexed with bct, zn; mutant

Details for d1dxka_

PDB Entry: 1dxk (more details), 1.85 Å

PDB Description: metallo-beta-lactamase from bacillus cereus 569/h/9 c168s mutant
PDB Compounds: (A:) class b beta-lactamase

SCOP Domain Sequences for d1dxka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxka_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggslvkstsakdlgnvadayv
newstsienvlkryrninavvpghgevgdkglllhtldllk

SCOP Domain Coordinates for d1dxka_:

Click to download the PDB-style file with coordinates for d1dxka_.
(The format of our PDB-style files is described here.)

Timeline for d1dxka_: