Lineage for d1bc2a_ (1bc2 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85090Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
  4. 85091Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (3 families) (S)
  5. 85092Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 85093Protein Zn metallo-beta-lactamase [56283] (4 species)
  7. 85094Species Bacillus cereus [TaxId:1396] [56284] (6 PDB entries)
  8. 85098Domain d1bc2a_: 1bc2 A: [42034]

Details for d1bc2a_

PDB Entry: 1bc2 (more details), 1.9 Å

PDB Description: zn-dependent metallo-beta-lactamase from bacillus cereus

SCOP Domain Sequences for d1bc2a_:

Sequence, based on SEQRES records: (download)

>d1bc2a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus}
tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
newstsienvlkryrninavvpghgevgdkglllhtldllk

Sequence, based on observed residues (ATOM records): (download)

>d1bc2a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus}
tviknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliemv
ekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvt
nlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnewst
sienvlkryrninavvpghgevgdkglllhtldllk

SCOP Domain Coordinates for d1bc2a_:

Click to download the PDB-style file with coordinates for d1bc2a_.
(The format of our PDB-style files is described here.)

Timeline for d1bc2a_: