Lineage for d7aagb_ (7aag B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2736776Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2736777Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries)
    Uniprot Q08499 388-713
  8. 3084018Domain d7aagb_: 7aag B: [420335]
    automated match to d3g58d_
    complexed with dms, edo, epe, ile, mg, peg, pro, qwt, zn

Details for d7aagb_

PDB Entry: 7aag (more details), 1.79 Å

PDB Description: crystal structure of human phosphodiesterase 4d2 catalytic domain with inhibitor npd-617
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d7aagb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7aagb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
edvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylmt
ledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgvs
nqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidiv
latdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplql
yrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlv
hpdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d7aagb_:

Click to download the PDB-style file with coordinates for d7aagb_.
(The format of our PDB-style files is described here.)

Timeline for d7aagb_:

  • d7aagb_ is new in SCOPe 2.08-stable