Lineage for d3bc2__ (3bc2 -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85090Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
  4. 85091Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (3 families) (S)
  5. 85092Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 85093Protein Zn metallo-beta-lactamase [56283] (4 species)
  7. 85094Species Bacillus cereus [TaxId:1396] [56284] (6 PDB entries)
  8. 85097Domain d3bc2__: 3bc2 - [42033]

Details for d3bc2__

PDB Entry: 3bc2 (more details), 1.7 Å

PDB Description: metallo beta-lactamase ii from bacillus cereus 569/h/9 at ph 6.0, monoclinic crystal form

SCOP Domain Sequences for d3bc2__:

Sequence, based on SEQRES records: (download)

>d3bc2__ d.157.1.1 (-) Zn metallo-beta-lactamase {Bacillus cereus}
viknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltkel
iemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdl
qtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggalvkstsakdlgnvadayvn
ewstsienvlkryrninavvpghgevgdkglllhtldllk

Sequence, based on observed residues (ATOM records): (download)

>d3bc2__ d.157.1.1 (-) Zn metallo-beta-lactamase {Bacillus cereus}
viknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliemve
kkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvtn
lkfgnmkvetfypgkghtednivvwlpqynilvggalvkstsakdlgnvadayvnewsts
ienvlkryrninavvpghgevgdkglllhtldllk

SCOP Domain Coordinates for d3bc2__:

Click to download the PDB-style file with coordinates for d3bc2__.
(The format of our PDB-style files is described here.)

Timeline for d3bc2__: