Lineage for d2bc2a_ (2bc2 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198117Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
  4. 198118Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (3 families) (S)
  5. 198119Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 198120Protein Zn metallo-beta-lactamase [56283] (4 species)
  7. 198121Species Bacillus cereus [TaxId:1396] [56284] (6 PDB entries)
  8. 198122Domain d2bc2a_: 2bc2 A: [42031]

Details for d2bc2a_

PDB Entry: 2bc2 (more details), 1.7 Å

PDB Description: metallo beta-lactamase ii from bacillus cereus 569/h/9 at ph 6.0, trigonal crystal form

SCOP Domain Sequences for d2bc2a_:

Sequence, based on SEQRES records: (download)

>d2bc2a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus}
tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggalvkstsakdlgnvadayv
newstsienvlkryrninavvpghgevgdkglllhtldllk

Sequence, based on observed residues (ATOM records): (download)

>d2bc2a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus}
tviknetgtisisqlnknvwvhtelgseavpsnglvlntskglvlvdsswddkltkelie
mvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqt
vtnlkfgnmkvetfypgkghtednivvwlpqynilvggalvkstsakdlgnvadayvnew
stsienvlkryrninavvpghgevgdkglllhtldllk

SCOP Domain Coordinates for d2bc2a_:

Click to download the PDB-style file with coordinates for d2bc2a_.
(The format of our PDB-style files is described here.)

Timeline for d2bc2a_: