Lineage for d7a9vc_ (7a9v C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2736776Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2736777Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries)
    Uniprot Q08499 388-713
  8. 3083935Domain d7a9vc_: 7a9v C: [420252]
    automated match to d3g58d_
    complexed with edo, epe, mg, peg, r5z, zn

Details for d7a9vc_

PDB Entry: 7a9v (more details), 2.17 Å

PDB Description: crystal structure of human phosphodiesterase 4d2 catalytic domain with inhibitor npd-635
PDB Compounds: (C:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d7a9vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a9vc_ a.211.1.2 (C:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
eqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlityl
mtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpg
vsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvid
ivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkpl
qlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwad
lvhpdaqdildtlednrewyqstip

SCOPe Domain Coordinates for d7a9vc_:

Click to download the PDB-style file with coordinates for d7a9vc_.
(The format of our PDB-style files is described here.)

Timeline for d7a9vc_:

  • d7a9vc_ is new in SCOPe 2.08-stable