SCOPe 2.08: Domain d7a2mb_: 7a2m B:

Lineage for d7a2mb_ (7a2m B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50049] (32 PDB entries)

8. Domain d7a2mb_: 7a2m B: [420246]
   automated match to d3ua6b_
   complexed with fmt, na, so4; mutant

Details for d7a2mb_

PDB Entry: 7a2m, 1.5 Å

PDB Description: crystal structure of the fyn sh3 domain a95s-d99t mutant in c21 space group

PDB Compounds: (B:) Tyrosine-protein kinase Fyn

SCOPe Domain Sequences for d7a2mb_:

Sequence; same for both SEQRES and ATOM records:

>d7a2mb_ b.34.2.1 (B:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
gvtlfvalydyesrtetdlsfhkgekfqilnssegdwwearslttgetgyipsnyvapvd

Timeline for d7a2mb_:

• d7a2mb_ is new in SCOPe 2.08-stable