![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (20 species) not a true protein |
![]() | Species Chitinophagaceae bacterium [TaxId:1869212] [420244] (1 PDB entry) |
![]() | Domain d7a03a_: 7a03 A: [420245] automated match to d5givb_ complexed with cit, gol, peg |
PDB Entry: 7a03 (more details), 1.39 Å
SCOPe Domain Sequences for d7a03a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a03a_ d.92.1.0 (A:) automated matches {Chitinophagaceae bacterium [TaxId: 1869212]} aeqyaaykqkmqkiadvrnaiavlgwdqetylpekgagfrgqqittlstiahelftapel gsllhelhhhpeldavqqknialsledydknkkypaslvaeiseatnqayhawikarkan dyqvfepalarmvelkrkettvlgyedhpynallneyekganvdmldtiftevktalspl lddiakqtparrdflhlhfdrdkqwqlgidllrqmgydmsagrqdisehpfttsfnpldv rvttridendfsnmtwscihegghalyeqglpteqyglpcgeaaslgihesqsrlwennv grslnfwkfqypriqalfpeqlgnvslqefykainhvqpslirteadeityhfhimirye iekglidgsistkdlnktwndyyrqylhvevpndtqgvlqdihwshgsfgyfptyslgsf yaaqffttaqkqvpdldvsiasgnyqpllewlrnnihpfgrfytsnelcqkitgnplqfs yfldyaagkflrg
Timeline for d7a03a_: