Lineage for d7adxa_ (7adx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688404Species Amphitrite ornata [TaxId:129555] [189339] (47 PDB entries)
  8. 3083917Domain d7adxa_: 7adx A: [420234]
    automated match to d5lkva_
    complexed with hem, oxy, so4

Details for d7adxa_

PDB Entry: 7adx (more details), 1.85 Å

PDB Description: sfx structure of dehaloperoxidase b in the oxyferrous form
PDB Compounds: (A:) Dehaloperoxidase B

SCOPe Domain Sequences for d7adxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7adxa_ a.1.1.2 (A:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d7adxa_:

Click to download the PDB-style file with coordinates for d7adxa_.
(The format of our PDB-style files is described here.)

Timeline for d7adxa_:

  • d7adxa_ is new in SCOPe 2.08-stable