SCOPe 2.08: Domain d7a37b_: 7a37 B:

Lineage for d7a37b_ (7a37 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein c-src protein tyrosine kinase [50064] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50066] (28 PDB entries)

8. Domain d7a37b_: 7a37 B: [420231]
   automated match to d6xvma_
   complexed with ure; mutant

Details for d7a37b_

PDB Entry: 7a37, 1.52 Å

PDB Description: crystal structure of the c-src sh3 domain mutant v111l-n113s-t114s in 3 m urea

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d7a37b_:

Sequence; same for both SEQRES and ATOM records:

>d7a37b_ b.34.2.1 (B:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
gvttfvalydyesrtetdlsfkkgerlqilnssegdwwlahslttgqtgyipsnyvapsd

Timeline for d7a37b_:

• d7a37b_ is new in SCOPe 2.08-stable