![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50049] (32 PDB entries) |
![]() | Domain d7a2na_: 7a2n A: [420222] automated match to d3ua6b_ complexed with fmt, na; mutant |
PDB Entry: 7a2n (more details), 1.4 Å
SCOPe Domain Sequences for d7a2na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a2na_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} vtlfvalydyesrtetdlsfhkgekfqilnssegdwwearslttgetgyipsnyvapvd
Timeline for d7a2na_: